PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678394014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 155aa    MW: 17795.1 Da    PI: 9.7581
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678394014genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.23.6e-10781112255
                SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +yps+++++ LA+++gL+ rq+ +WF N+R ++
  678394014  78 WPYPSEAQKTALAESTGLDRRQINNWFINQRKRH 111
                58*****************************985 PP

2ELK34.83.5e-123252222
        ELK  2 LKhqLlrKYsgyLgsLkqEFs 22
                K qLlrKYsg+LgsLkqE++
  678394014 32 FKGQLLRKYSGCLGSLKQELM 52
               599****************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512139.763151IPR005539ELK domain
SMARTSM011881.6E-63152IPR005539ELK domain
PfamPF037894.8E-93352IPR005539ELK domain
PROSITE profilePS5007112.87651114IPR001356Homeobox domain
SuperFamilySSF466898.13E-2053122IPR009057Homeodomain-like
SMARTSM003894.0E-1353118IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.6E-2856117IPR009057Homeodomain-like
CDDcd000864.50E-1163115No hitNo description
PfamPF059205.0E-1871110IPR008422Homeobox KN domain
PROSITE patternPS00027089112IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MERTGSSSEE LELDANNSNS SFIHPQAEDD EFKGQLLRKY SGCLGSLKQE LMKKRKKGKL  60
PKDARHKLLD WWSRHYKWPY PSEAQKTALA ESTGLDRRQI NNWFINQRKR HWKPSEETQF  120
VAMDAAEAAA HLNNVLGNPF AMNVSAAISQ LPQQL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14655LKQELMKKRK
25256KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444605.13e-67PREDICTED: homeobox protein SBH1-like
SwissprotO222995e-62LET6_SOLLC; Homeobox protein knotted-1-like LET6
TrEMBLQ8GUC46e-73Q8GUC4_HELTU; Putative knotted-1-like protein
STRINGPOPTR_0011s01590.11e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68352433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.14e-57KNOX/ELK homeobox transcription factor